— Compound · Class B GPCR ligand (secretin / VIP / PACAP / glucagon superfamily)

VIP (Vasoactive Intestinal Peptide)

VIP (VASOACTIVE INTESTINAL PEPTIDE) · LYOPHILIZED · RESEARCH USE ONLY

28-residue amidated peptide HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ of the secretin / glucagon superfamily. C₁₄₇H₂₃₇N₄₃O₄₃S, MW 3326.81 Da.

$96.00Per 10 mg vial
Vial size 10 mg
Quantity1 vial
Quantity
Shipping & returns
Vial sizes listedChoose the required strength
Retail pricingShown by vial strength
U.S. laboratoryPrepared in the United States
Research supportOne-business-day target

Research Use Only. Not for human or animal consumption.

About the compound

28-residue amidated peptide HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ of the secretin / glucagon superfamily. C₁₄₇H₂₃₇N₄₃O₄₃S, MW 3326.81 Da.

Review the compound details and your selected vial strength before ordering. For questions about this material or lot-specific documents, contact our team.

Specifications

SequenceHSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Length28 residues
Molecular formulaC147H237N43O43S
Molecular weight3326.81 Da
Parent familyClass B GPCR ligand (secretin / VIP / PACAP / glucagon superfamily)
FormLyophilized powder (white to off-white)
StorageFollow the product label or verified order-specific record
Chemistry classClass B GPCR ligand (secretin / VIP / PACAP / glucagon superfamily)
Intended UseResearch use only — not for human or animal consumption

Storage & handling

Keep the vial sealed, dry, protected from direct light, and within the storage range printed on the product label or supplied with the corresponding order record.

Handling and preparation procedures are determined by the qualified laboratory for its validated in-vitro protocol. Peptides.vc does not provide human or veterinary administration, dosing, or preparation instructions.

Research use only

By placing an order with Peptides.vc, you acknowledge and confirm that:
- All products are intended exclusively for in-vitro research and laboratory use only.
- Products are not intended for human or animal consumption, nor for diagnostic, therapeutic, or clinical applications.
- You are familiar with your jurisdiction's regulations regarding research chemicals and their proper handling.
- You understand the safety protocols required for handling research peptides and will ensure proper storage.
- You are at least 21 years of age and represent a qualified research institution or are a licensed researcher.
- Peptides.vc, this website, and our affiliates are not responsible for how you use or store these items once delivered, to the fullest extent allowed by law.