— Compound · Human cathelicidin antimicrobial peptide

LL-37

LL-37 · LYOPHILIZED · COA PENDING

37-residue human cathelicidin antimicrobial peptide. C₂₀₅H₃₄₀N₆₀O₅₃, MW 4493.27 Da.

Price on requestFrom · per 1mg vial
Vial size1mg selected
Quantity1 vial
Quantity
COA pendingLot record pending
Documentation workflowPDF on verified release
Pricing pendingResearcher review required
Free U.S. shippingOver $200

Research Use Only. Not for human or animal consumption.

About the compound

37-residue human cathelicidin antimicrobial peptide. C₂₀₅H₃₄₀N₆₀O₅₃, MW 4493.27 Da.

LL-37 is the sole human cathelicidin antimicrobial peptide, processed from the C-terminus of the hCAP18 precursor (UniProt P49913). Sequence: [LL-37, 37 aa] Empirical formula C₂₀₅H₃₄₀N₆₀O₅₃; MW 4493.27 Da.

Reconstitution. For in-vitro laboratory handling, dissolve with bacteriostatic water (0.9% benzyl alcohol). Compound is hygroscopic — handle in low-humidity conditions and re-cap immediately.

Stability profile. Lyophilized: stable at room temperature for up to 30 days sealed; long-term storage at -20 °C recommended. Reconstituted material: stable at 2–8 °C for up to 14 days.

Selected primary literature.
- Gudmundsson GH et al., 1996, Eur J Biochem 238(2):325 — original isolation and structural characterization of LL-37 (preclinical).

What remains uncharacterized: concentration-response relationships in any specific in-vitro model system are not implied here. The literature cited above describes molecular-level observations only.

For research use only. Not for human or animal consumption.

Specifications

SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Length37 residues
Molecular formulaC205H340N60O53
Molecular weight4493.27 Da
Parent familyHuman cathelicidin antimicrobial peptide
FormLyophilized powder (white to off-white)
StorageRoom temperature up to 30 days · long-term −20 °C
Lot recordPending publication
DocumentationCOA pending
Chemistry classHuman cathelicidin antimicrobial peptide
Documentation statusCOA pending until lot release
Shipping OriginCalifornia, USA
Intended UseResearch use only — not for human or animal consumption

Certificate of Analysis

Lot-specific documentation is being staged for this catalog item. Verified researchers can request the current documentation status before ordering.

COA · Pending lot releaseIssued by Pending release
PurityPending
IdentityPending
EndotoxinPending
Request COA

Storage & handling

In transit / short term: the vial ships as a lyophilized powder and is room-temperature stable in transit. Lyophilized vials are stable at room temperature for up to 30 days after delivery if unopened.

Long term (unopened, lyophilized): store at −20 °C in a standard laboratory freezer, away from light. Lyophilized peptides under these conditions remain stable for 24+ months from the lyophilization date noted on the vial label and COA.

Reconstitution math: reconstitute with bacteriostatic water (typical 1 mL for a 1 mg vial → 1.00 mg/mL). Introduce the diluent slowly down the wall of the vial; do not agitate. Allow the powder to dissolve passively.

After reconstitution: refrigerate at 2–8 °C, protect from light, and use within the timeframe noted on the COA (typically 7–14 days for bacteriostatic-water reconstitution under sterile technique). Avoid repeated freeze-thaw cycles. Aliquot if multiple uses are planned.

Research use only

By placing an order with Verified Compounds, you acknowledge and confirm that:
- All products are intended exclusively for in-vitro research and laboratory use only.
- Products are not intended for human or animal consumption, nor for diagnostic, therapeutic, or clinical applications.
- You are familiar with your jurisdiction's regulations regarding research chemicals and their proper handling.
- You understand the safety protocols required for handling research peptides and will ensure proper storage.
- You are at least 21 years of age and represent a qualified research institution or are a licensed researcher.
- Verified Compounds, this website, and our affiliates are not responsible for how you use or store these items once delivered, to the fullest extent allowed by law.