LL-37

LL-37 is the sole human cathelicidin antimicrobial peptide, processed from the C-terminus of the hCAP18 precursor (UniProt P49913). Sequence: [LL-37, 37 aa] Empirical formula C₂₀₅H₃₄₀N₆₀O₅₃; MW 4493.27 Da.

Reconstitution. For in-vitro laboratory handling, dissolve with bacteriostatic water (0.9% benzyl alcohol). Compound is hygroscopic — handle in low-humidity conditions and re-cap immediately.

Stability profile. Lyophilized: stable at room temperature for up to 30 days sealed; long-term storage at -20 °C recommended. Reconstituted material: stable at 2–8 °C for up to 14 days.

Selected primary literature.
- Gudmundsson GH et al., 1996, Eur J Biochem 238(2):325 — original isolation and structural characterization of LL-37 (preclinical).

What remains uncharacterized: concentration-response relationships in any specific in-vitro model system are not implied here. The literature cited above describes molecular-level observations only.

For research use only. Not for human or animal consumption.

By placing an order with Verified Compounds, you acknowledge and confirm that:
- All products are intended exclusively for in-vitro research and laboratory use only.
- Products are not intended for human or animal consumption, nor for diagnostic, therapeutic, or clinical applications.
- You are familiar with your jurisdiction's regulations regarding research chemicals and their proper handling.
- You understand the safety protocols required for handling research peptides and will ensure proper storage.
- You are at least 21 years of age and represent a qualified research institution or are a licensed researcher.
- Verified Compounds, this website, and our affiliates are not responsible for how you use or store these items once delivered, to the fullest extent allowed by law.