Structural identity
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Also known as: vasoactive intestinal polypeptide
Structural notes. C-terminal amide. UniProt P01282 (residues 125–152). Said SI & Mutt V, 1970, Science 169(3951):1217.
Catalog handling boundary
This reference records structural identity only. Laboratory handling and preparation must follow the product label, any verified order-specific documentation, and the qualified laboratory's validated in-vitro protocol.
No universal diluent, concentration, shelf-life, or storage condition is asserted on this public page. Nothing here is a human or veterinary dosing, administration, or preparation instruction.
What the primary literature describes
The references below describe in-vitro, preclinical, or structural observations cited in published peer-reviewed work. What the literature reports is summarized in chemistry terms. The references are cited because they describe the molecule — its sequence, its structure, its receptor interactions — not because they support any outcome claim.
- C-terminal amide. UniProt P01282 (residues 125–152). Said SI & Mutt V, 1970, Science 169(3951):1217.
What is not established here
This page does not state, imply, or summarize any therapeutic outcome. The molecule is presented as a chemistry object — sequence, mass, structural family, and the structural-characterization literature that describes it. Dose-response relationships in any specific in-vitro model system, claims of efficacy in any human or animal context, and outcome statements of any kind are deliberately outside the scope of this page.
What a qualified investigator chooses to investigate, and how, is the investigator's responsibility under their institution's research-use framework. Peptides.vc supplies the reagent and the chemistry-only reference data; nothing more is implied.
For research use only. Not for human or animal consumption.